Lineage for d1jpfb_ (1jpf B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220595Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (13 PDB entries)
  8. 220597Domain d1jpfb_: 1jpf B: [67018]
    Other proteins in same PDB: d1jpfa2

Details for d1jpfb_

PDB Entry: 1jpf (more details), 2.18 Å

PDB Description: Crystal Structure Of The LCMV Peptidic Epitope Gp276 In Complex With The Murine Class I Mhc Molecule H-2Db

SCOP Domain Sequences for d1jpfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpfb_ b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1jpfb_:

Click to download the PDB-style file with coordinates for d1jpfb_.
(The format of our PDB-style files is described here.)

Timeline for d1jpfb_: