Lineage for d1jpaa_ (1jpa A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672892Protein ephb2 receptor tyrosine kinase [69827] (1 species)
    PTK group; Eph/Elk/Eck subfamily; membrane spanning protein tyrosine kinase
  7. 1672893Species Mouse (Mus musculus) [TaxId:10090] [69828] (1 PDB entry)
  8. 1672894Domain d1jpaa_: 1jpa A: [67011]
    complexed with anp

Details for d1jpaa_

PDB Entry: 1jpa (more details), 1.91 Å

PDB Description: Crystal Structure of unphosphorylated EphB2 receptor tyrosine kinase and juxtamembrane region
PDB Compounds: (A:) neural kinase, Nuk=Eph/Elk/Eck family receptor-like tyrosine kinase

SCOPe Domain Sequences for d1jpaa_:

Sequence, based on SEQRES records: (download)

>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklpgkreifvaik
tlksgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrq
ndgqftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfglsrfled
dtsdptytsalggkipirwtapeaiqyrkftsasdvwsygivmwevmsygerpywdmtnq
dvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgqivntldkmirnpnslka

Sequence, based on observed residues (ATOM records): (download)

>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklreifvaiktlk
sgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrqndg
qftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfpirwtapeaiq
yrkftsasdvwsygivmwevmsygerpywdmtnqdvinaieqdyrlpppmdcpsalhqlm
ldcwqkdrnhrpkfgqivntldkmirnpnslka

SCOPe Domain Coordinates for d1jpaa_:

Click to download the PDB-style file with coordinates for d1jpaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jpaa_: