Lineage for d1jpaa_ (1jpa A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138202Family d.144.1.2: Tyrosine kinase [56150] (11 proteins)
  6. 138219Protein ephb2 receptor tyrosine kinase [69827] (1 species)
  7. 138220Species Mouse (Mus musculus) [TaxId:10090] [69828] (1 PDB entry)
  8. 138221Domain d1jpaa_: 1jpa A: [67011]

Details for d1jpaa_

PDB Entry: 1jpa (more details), 1.91 Å

PDB Description: Crystal Structure of unphosphorylated EphB2 receptor tyrosine kinase and juxtamembrane region

SCOP Domain Sequences for d1jpaa_:

Sequence, based on SEQRES records: (download)

>d1jpaa_ d.144.1.2 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus)}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklpgkreifvaik
tlksgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrq
ndgqftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfglsrfled
dtsdptytsalggkipirwtapeaiqyrkftsasdvwsygivmwevmsygerpywdmtnq
dvinaieqdyrlpppmdcpsalhqlmldcwqkdrnhrpkfgqivntldkmirnpnslka

Sequence, based on observed residues (ATOM records): (download)

>d1jpaa_ d.144.1.2 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus)}
kifidpftfedpneavrefakeidiscvkieqvigagefgevcsghlklreifvaiktlk
sgytekqrrdflseasimgqfdhpnvihlegvvtkstpvmiitefmengsldsflrqndg
qftviqlvgmlrgiaagmkyladmnyvhrdlaarnilvnsnlvckvsdfpirwtapeaiq
yrkftsasdvwsygivmwevmsygerpywdmtnqdvinaieqdyrlpppmdcpsalhqlm
ldcwqkdrnhrpkfgqivntldkmirnpnslka

SCOP Domain Coordinates for d1jpaa_:

Click to download the PDB-style file with coordinates for d1jpaa_.
(The format of our PDB-style files is described here.)

Timeline for d1jpaa_: