Lineage for d1jp5b2 (1jp5 B:128-247)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158586Species scFv 1695, (mouse), kappa L chain [69138] (1 PDB entry)
  8. 158590Domain d1jp5b2: 1jp5 B:128-247 [67004]

Details for d1jp5b2

PDB Entry: 1jp5 (more details), 2.7 Å

PDB Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-1 protease

SCOP Domain Sequences for d1jp5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jp5b2 b.1.1.1 (B:128-247) Immunoglobulin (variable domains of L and H chains) {scFv 1695, (mouse), kappa L chain}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss

SCOP Domain Coordinates for d1jp5b2:

Click to download the PDB-style file with coordinates for d1jp5b2.
(The format of our PDB-style files is described here.)

Timeline for d1jp5b2:

Domains from same chain:
(mouse over for more information)
d1jp5b1
Domains from other chains:
(mouse over for more information)
d1jp5a1, d1jp5a2