Lineage for d1jp5b1 (1jp5 B:1-112)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 103085Species scFv 1695, (mouse), kappa L chain [69138] (1 PDB entry)
  8. 103088Domain d1jp5b1: 1jp5 B:1-112 [67003]

Details for d1jp5b1

PDB Entry: 1jp5 (more details), 2.7 Å

PDB Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-1 protease

SCOP Domain Sequences for d1jp5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jp5b1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {scFv 1695, (mouse), kappa L chain}
dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleik

SCOP Domain Coordinates for d1jp5b1:

Click to download the PDB-style file with coordinates for d1jp5b1.
(The format of our PDB-style files is described here.)

Timeline for d1jp5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jp5b2