![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species scFv 1695, (mouse), kappa L chain [69138] (1 PDB entry) |
![]() | Domain d1jp5b1: 1jp5 B:1-112 [67003] |
PDB Entry: 1jp5 (more details), 2.7 Å
SCOP Domain Sequences for d1jp5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jp5b1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {scFv 1695, (mouse), kappa L chain} dilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleik
Timeline for d1jp5b1: