SCOP 1.59: Domain d1jp5a2: 1jp5 A:128-247

Lineage for d1jp5a2 (1jp5 A:128-247)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species scFv 1695, (mouse), kappa L chain [69138] (1 PDB entry)

8. Domain d1jp5a2: 1jp5 A:128-247 [67002]

Details for d1jp5a2

PDB Entry: 1jp5, 2.7 Å

PDB Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-1 protease

SCOP Domain Sequences for d1jp5a2:

Sequence; same for both SEQRES and ATOM records:

>d1jp5a2 b.1.1.1 (A:128-247) Immunoglobulin (variable domains of L and H chains) {scFv 1695, (mouse), kappa L chain}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss

Timeline for d1jp5a2:

• d1jp5a2 is new in SCOP 1.59
  
• d1jp5a2 appears in SCOP 1.61
  
• d1jp5a2 appears in the current release, SCOPe 2.08