Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species scFv 1695, (mouse), kappa L chain [69138] (1 PDB entry) |
Domain d1jp5a2: 1jp5 A:128-247 [67002] |
PDB Entry: 1jp5 (more details), 2.7 Å
SCOP Domain Sequences for d1jp5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jp5a2 b.1.1.1 (A:128-247) Immunoglobulin (variable domains of L and H chains) {scFv 1695, (mouse), kappa L chain} evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss
Timeline for d1jp5a2: