Lineage for d1jnyb3 (1jny B:4-227)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 121996Protein Elongation factor eEF-1alpha, N-terminal (G) domain [52631] (2 species)
  7. 121997Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69487] (1 PDB entry)
  8. 121999Domain d1jnyb3: 1jny B:4-227 [66987]
    Other proteins in same PDB: d1jnya1, d1jnya2, d1jnyb1, d1jnyb2

Details for d1jnyb3

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP

SCOP Domain Sequences for d1jnyb3:

Sequence, based on SEQRES records: (download)

>d1jnyb3 c.37.1.8 (B:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrlk
eerergvtinltfmrfetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeye
agmsvegqtrehiilaktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfn
tnkvrfvpvvapsgdnithksenmkwyngptleeyldqlelppk

Sequence, based on observed residues (ATOM records): (download)

>d1jnyb3 c.37.1.8 (B:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus}
kphlnlivighvdhgkstlvgrllmdrgfidektvkeaeeaakklgkesekfaflldrmr
fetkkyfftiidapghrdfvknmitgasqadaailvvsakkgeyeagmsvegqtrehiil
aktmgldqlivavnkmdlteppydekrykeivdqvskfmrsygfntnkvrfvpvvapsgd
nithksenmkwyngptleeyldqlelppk

SCOP Domain Coordinates for d1jnyb3:

Click to download the PDB-style file with coordinates for d1jnyb3.
(The format of our PDB-style files is described here.)

Timeline for d1jnyb3: