Lineage for d1jnyb2 (1jny B:323-430)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111495Fold b.44: EF-Tu/eEF-1alpha C-terminal domain [50464] (1 superfamily)
  4. 111496Superfamily b.44.1: EF-Tu/eEF-1alpha C-terminal domain [50465] (1 family) (S)
  5. 111497Family b.44.1.1: EF-Tu/eEF-1alpha C-terminal domain [50466] (2 proteins)
  6. 111498Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species)
  7. 111499Species Archaeon Sulfolobus solfataricus [TaxId:2287] [69277] (1 PDB entry)
  8. 111501Domain d1jnyb2: 1jny B:323-430 [66986]
    Other proteins in same PDB: d1jnya1, d1jnya3, d1jnyb1, d1jnyb3

Details for d1jnyb2

PDB Entry: 1jny (more details), 1.8 Å

PDB Description: Crystal structure of Sulfolobus solfataricus elongation factor 1 alpha in complex with GDP

SCOP Domain Sequences for d1jnyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnyb2 b.44.1.1 (B:323-430) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus}
adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq
gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkpa

SCOP Domain Coordinates for d1jnyb2:

Click to download the PDB-style file with coordinates for d1jnyb2.
(The format of our PDB-style files is described here.)

Timeline for d1jnyb2: