Lineage for d1jnrc3 (1jnr C:257-401)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737821Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 737822Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 737823Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 737824Protein Adenylylsulfate reductase A subunit [69852] (1 species)
  7. 737825Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69853] (2 PDB entries)
  8. 737827Domain d1jnrc3: 1jnr C:257-401 [66972]
    Other proteins in same PDB: d1jnra1, d1jnra2, d1jnrb_, d1jnrc1, d1jnrc2, d1jnrd_
    complexed with fad, fs4, gol

Details for d1jnrc3

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
PDB Compounds: (C:) adenylylsulfate reductase

SCOP Domain Sequences for d1jnrc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnrc3 d.168.1.1 (C:257-401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
fehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaelekykpygaaqpiptpl
rnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafedfldmtvsqallwacq
nidpqeqpseaapaepyimgshsge

SCOP Domain Coordinates for d1jnrc3:

Click to download the PDB-style file with coordinates for d1jnrc3.
(The format of our PDB-style files is described here.)

Timeline for d1jnrc3: