Lineage for d1jnrb_ (1jnr B:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.58: Ferredoxin-like [54861] (39 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (5 proteins) 
Protein Adenylylsulfate reductase B subunit [69726] (1 species) Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (1 PDB entry) 
Domain d1jnrb_: 1jnr B: [66969]
Other proteins in same PDB: d1jnra1, d1jnra2, d1jnra3, d1jnrc1, d1jnrc2, d1jnrc3
Details for d1jnrb_
PDB Entry: 1jnr (more details), 1.6 Å
PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
SCOP Domain Sequences for d1jnrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka
SCOP Domain Coordinates for d1jnrb_:
Click to download the PDB-style file with coordinates for d1jnrb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jnrb_:
- d1jnrb_ is new in SCOP 1.59
- d1jnrb_ appears in SCOP 1.61
- d1jnrb_ appears in the current release, SCOPe 2.08
View in 3D
