Lineage for d1jnra1 (1jnr A:503-643)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724459Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1724460Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1724461Protein Adenylylsulfate reductase A subunit [68978] (1 species)
  7. 1724462Species Archaeoglobus fulgidus [TaxId:2234] [68979] (2 PDB entries)
  8. 1724463Domain d1jnra1: 1jnr A:503-643 [66966]
    Other proteins in same PDB: d1jnra2, d1jnra3, d1jnrb_, d1jnrc2, d1jnrc3, d1jnrd_
    complexed with fad, gol, sf4

Details for d1jnra1

PDB Entry: 1jnr (more details), 1.6 Å

PDB Description: structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
PDB Compounds: (A:) adenylylsulfate reductase

SCOPe Domain Sequences for d1jnra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnra1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeoglobus fulgidus [TaxId: 2234]}
taddvnpeyilpwqglvrlqkimdeyaagiatiyktnekmlqralellaflkedleklaa
rdlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyyrtdypelndeewkcfvcskyd
aekdewtfekvpyvqviewsf

SCOPe Domain Coordinates for d1jnra1:

Click to download the PDB-style file with coordinates for d1jnra1.
(The format of our PDB-style files is described here.)

Timeline for d1jnra1: