Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Anti-estradiol Fab 17E12E5, (mouse), kappa L chain [69146] (2 PDB entries) |
Domain d1jnnl1: 1jnn L:1-107 [66962] Other proteins in same PDB: d1jnnh2, d1jnnl2 |
PDB Entry: 1jnn (more details), 3.2 Å
SCOP Domain Sequences for d1jnnl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnnl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 17E12E5, (mouse), kappa L chain} qivmtqtpaslsasvgetvtitcrasgniynylawyqqkqgkspqllvynaktlvdgvpl rfsgsgsgtqyslkinslqpedfgnyychhfwntpytfgggtkleik
Timeline for d1jnnl1: