Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69155] (2 PDB entries) |
Domain d1jnhh2: 1jnh H:121-217 [66954] Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhc1, d1jnhd1, d1jnhe1, d1jnhf1, d1jnhg1, d1jnhh1 complexed with eco |
PDB Entry: 1jnh (more details), 2.85 Å
SCOP Domain Sequences for d1jnhh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnhh2 b.1.1.2 (H:121-217) Immunoglobulin (constant domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain} ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdly tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
Timeline for d1jnhh2: