Lineage for d1jnhh1 (1jnh H:1-117)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652702Domain d1jnhh1: 1jnh H:1-117 [66953]
    Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb2, d1jnhc1, d1jnhc2, d1jnhd2, d1jnhe1, d1jnhe2, d1jnhf2, d1jnhg1, d1jnhg2, d1jnhh2
    part of anti-estradiol Fab 10G6D6
    complexed with eco

Details for d1jnhh1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes
PDB Compounds: (H:) monoclonal anti-estradiol 10g6d6 immunoglobulin gamma-1 chain

SCOP Domain Sequences for d1jnhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtv

SCOP Domain Coordinates for d1jnhh1:

Click to download the PDB-style file with coordinates for d1jnhh1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhh1: