Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries) Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3) |
Domain d1jnhg2: 1jnh G:112-211 [66952] Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhb2, d1jnhc1, d1jnhd1, d1jnhd2, d1jnhe1, d1jnhf1, d1jnhf2, d1jnhg1, d1jnhh1, d1jnhh2 part of anti-estradiol Fab 10G6D6 complexed with eco |
PDB Entry: 1jnh (more details), 2.85 Å
SCOP Domain Sequences for d1jnhg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnhg2 b.1.1.2 (G:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]} ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn nkymassyltltarawerhssyscqvtheghtvekslsaa
Timeline for d1jnhg2: