Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (391 PDB entries) Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form |
Domain d1jnhf2: 1jnh F:121-217 [66950] Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb1, d1jnhc1, d1jnhc2, d1jnhd1, d1jnhe1, d1jnhe2, d1jnhf1, d1jnhg1, d1jnhg2, d1jnhh1 part of anti-estradiol Fab 10G6D6 complexed with eco |
PDB Entry: 1jnh (more details), 2.85 Å
SCOPe Domain Sequences for d1jnhf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnhf2 b.1.1.2 (F:121-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvswntgslssgvhtfpavlqsdly tlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
Timeline for d1jnhf2: