Lineage for d1jnhf1 (1jnh F:1-117)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287419Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)
  8. 287523Domain d1jnhf1: 1jnh F:1-117 [66949]
    Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb2, d1jnhc1, d1jnhc2, d1jnhd2, d1jnhe1, d1jnhe2, d1jnhf2, d1jnhg1, d1jnhg2, d1jnhh2

Details for d1jnhf1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhf1 b.1.1.1 (F:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtv

SCOP Domain Coordinates for d1jnhf1:

Click to download the PDB-style file with coordinates for d1jnhf1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhf1: