Lineage for d1jnhf1 (1jnh F:1-117)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102054Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69145] (2 PDB entries)
  8. 102060Domain d1jnhf1: 1jnh F:1-117 [66949]
    Other proteins in same PDB: d1jnha2, d1jnhb2, d1jnhc2, d1jnhd2, d1jnhe2, d1jnhf2, d1jnhg2, d1jnhh2

Details for d1jnhf1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes
PDB Compounds: (F:)

SCOP Domain Sequences for d1jnhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhf1 b.1.1.1 (F:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain}
evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtv

SCOP Domain Coordinates for d1jnhf1:

Click to download the PDB-style file with coordinates for d1jnhf1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhf1: