Lineage for d1jnhe1 (1jnh E:1-108)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783480Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 783574Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)
  8. 783607Domain d1jnhe1: 1jnh E:1-108 [66947]
    Other proteins in same PDB: d1jnha2, d1jnhb1, d1jnhb2, d1jnhc2, d1jnhd1, d1jnhd2, d1jnhe2, d1jnhf1, d1jnhf2, d1jnhg2, d1jnhh1, d1jnhh2
    part of anti-estradiol Fab 10G6D6

Details for d1jnhe1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes
PDB Compounds: (E:) monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain

SCOP Domain Sequences for d1jnhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhe1 b.1.1.1 (E:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtv

SCOP Domain Coordinates for d1jnhe1:

Click to download the PDB-style file with coordinates for d1jnhe1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhe1: