Lineage for d1jnhe1 (1jnh E:1-108)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219018Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69145] (2 PDB entries)
  8. 219023Domain d1jnhe1: 1jnh E:1-108 [66947]
    Other proteins in same PDB: d1jnha2, d1jnhb2, d1jnhc2, d1jnhd2, d1jnhe2, d1jnhf2, d1jnhg2, d1jnhh2

Details for d1jnhe1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhe1 b.1.1.1 (E:1-108) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtv

SCOP Domain Coordinates for d1jnhe1:

Click to download the PDB-style file with coordinates for d1jnhe1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhe1: