Lineage for d1jnhc2 (1jnh C:112-211)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293989Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1294075Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 1294093Domain d1jnhc2: 1jnh C:112-211 [66944]
    Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhb2, d1jnhc1, d1jnhd1, d1jnhd2, d1jnhe1, d1jnhf1, d1jnhf2, d1jnhg1, d1jnhh1, d1jnhh2
    part of anti-estradiol Fab 10G6D6
    complexed with eco

Details for d1jnhc2

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes
PDB Compounds: (C:) monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain

SCOPe Domain Sequences for d1jnhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhc2 b.1.1.2 (C:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn
nkymassyltltarawerhssyscqvtheghtvekslsaa

SCOPe Domain Coordinates for d1jnhc2:

Click to download the PDB-style file with coordinates for d1jnhc2.
(The format of our PDB-style files is described here.)

Timeline for d1jnhc2: