Lineage for d1jnhc2 (1jnh C:112-211)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550231Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 550310Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
  8. 550328Domain d1jnhc2: 1jnh C:112-211 [66944]
    Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhb2, d1jnhc1, d1jnhd1, d1jnhd2, d1jnhe1, d1jnhf1, d1jnhf2, d1jnhg1, d1jnhh1, d1jnhh2

Details for d1jnhc2

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhc2 b.1.1.2 (C:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn
nkymassyltltarawerhssyscqvtheghtvekslsaa

SCOP Domain Coordinates for d1jnhc2:

Click to download the PDB-style file with coordinates for d1jnhc2.
(The format of our PDB-style files is described here.)

Timeline for d1jnhc2: