Lineage for d1jnhc2 (1jnh C:112-211)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159271Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69155] (2 PDB entries)
  8. 159274Domain d1jnhc2: 1jnh C:112-211 [66944]
    Other proteins in same PDB: d1jnha1, d1jnhb1, d1jnhc1, d1jnhd1, d1jnhe1, d1jnhf1, d1jnhg1, d1jnhh1

Details for d1jnhc2

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhc2 b.1.1.2 (C:112-211) Immunoglobulin (constant domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain}
ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn
nkymassyltltarawerhssyscqvtheghtvekslsaa

SCOP Domain Coordinates for d1jnhc2:

Click to download the PDB-style file with coordinates for d1jnhc2.
(The format of our PDB-style files is described here.)

Timeline for d1jnhc2: