SCOP 1.67: Domain d1jnhc1: 1jnh C:1-108

Lineage for d1jnhc1 (1jnh C:1-108)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (33 PDB entries)

8. Domain d1jnhc1: 1jnh C:1-108 [66943]
   Other proteins in same PDB: d1jnha2, d1jnhb1, d1jnhb2, d1jnhc2, d1jnhd1, d1jnhd2, d1jnhe2, d1jnhf1, d1jnhf2, d1jnhg2, d1jnhh1, d1jnhh2

Details for d1jnhc1

PDB Entry: 1jnh, 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhc1:

Sequence; same for both SEQRES and ATOM records:

>d1jnhc1 b.1.1.1 (C:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus)}
qavvtqesalttspgetvtltcrsssgaittshyanwiqekpdhlftglisgtnnrapgv
parfsgsligdkaaltitgaqtedeaiyicalwfsnqfifgsgtkvtv

Timeline for d1jnhc1:

• d1jnhc1 first appeared in SCOP 1.59
  
• d1jnhc1 appears in SCOP 1.65
  
• d1jnhc1 appears in SCOP 1.69
  
• d1jnhc1 appears in the current release, SCOPe 2.08