Lineage for d1jnhb1 (1jnh B:1-117)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103919Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1104056Domain d1jnhb1: 1jnh B:1-117 [66941]
    Other proteins in same PDB: d1jnha1, d1jnha2, d1jnhb2, d1jnhc1, d1jnhc2, d1jnhd2, d1jnhe1, d1jnhe2, d1jnhf2, d1jnhg1, d1jnhg2, d1jnhh2
    part of anti-estradiol Fab 10G6D6
    complexed with eco

Details for d1jnhb1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes
PDB Compounds: (B:) monoclonal anti-estradiol 10g6d6 immunoglobulin gamma-1 chain

SCOPe Domain Sequences for d1jnhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtv

SCOPe Domain Coordinates for d1jnhb1:

Click to download the PDB-style file with coordinates for d1jnhb1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhb1: