Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69145] (2 PDB entries) |
Domain d1jnhb1: 1jnh B:1-117 [66941] Other proteins in same PDB: d1jnha2, d1jnhb2, d1jnhc2, d1jnhd2, d1jnhe2, d1jnhf2, d1jnhg2, d1jnhh2 |
PDB Entry: 1jnh (more details), 2.85 Å
SCOP Domain Sequences for d1jnhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain} evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtv
Timeline for d1jnhb1: