Lineage for d1jnhb1 (1jnh B:1-117)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157480Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69145] (2 PDB entries)
  8. 157482Domain d1jnhb1: 1jnh B:1-117 [66941]
    Other proteins in same PDB: d1jnha2, d1jnhb2, d1jnhc2, d1jnhd2, d1jnhe2, d1jnhf2, d1jnhg2, d1jnhh2

Details for d1jnhb1

PDB Entry: 1jnh (more details), 2.85 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jnhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain}
evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtv

SCOP Domain Coordinates for d1jnhb1:

Click to download the PDB-style file with coordinates for d1jnhb1.
(The format of our PDB-style files is described here.)

Timeline for d1jnhb1: