Lineage for d1jnab_ (1jna B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184079Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 184080Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 184089Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (1 protein)
  6. 184090Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 184091Species Cow (Bos taurus) [TaxId:9913] [53454] (10 PDB entries)
  8. 184106Domain d1jnab_: 1jna B: [66932]
    Other proteins in same PDB: d1jnaa_, d1jnac_

Details for d1jnab_

PDB Entry: 1jna (more details), 2.3 Å

PDB Description: beta-1,4-galactosyltransferase complex with alpha-lactalbumin and N-butanoyl-glucoamine

SCOP Domain Sequences for d1jnab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnab_ c.68.1.2 (B:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus)}
tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
sdglnsltymvlevqryplytkitvdigtps

SCOP Domain Coordinates for d1jnab_:

Click to download the PDB-style file with coordinates for d1jnab_.
(The format of our PDB-style files is described here.)

Timeline for d1jnab_: