Lineage for d1jn6b1 (1jn6 B:1-117)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102054Species Anti-estradiol Fab 10G6D6, (mouse), lambda L chain [69145] (2 PDB entries)
  8. 102064Domain d1jn6b1: 1jn6 B:1-117 [66925]
    Other proteins in same PDB: d1jn6a2, d1jn6b2

Details for d1jn6b1

PDB Entry: 1jn6 (more details), 2.7 Å

PDB Description: crystal structure of fab-estradiol complexes

SCOP Domain Sequences for d1jn6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn6b1 b.1.1.1 (B:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-estradiol Fab 10G6D6, (mouse), lambda L chain}
evqlqqsgaelarpgasvklscrtsgysfttywmqwvrqrpgqglewiaaiypgdddary
tqkfkgkatltadrsssivylqlnsltsedsavyscsrgrslyytmdywgqgtsvtv

SCOP Domain Coordinates for d1jn6b1:

Click to download the PDB-style file with coordinates for d1jn6b1.
(The format of our PDB-style files is described here.)

Timeline for d1jn6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jn6b2