Lineage for d1jn6a2 (1jn6 A:113-210)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762390Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1762475Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 1762496Domain d1jn6a2: 1jn6 A:113-210 [66924]
    Other proteins in same PDB: d1jn6a1, d1jn6b1, d1jn6b2
    part of anti-estradiol Fab 10G6D6

Details for d1jn6a2

PDB Entry: 1jn6 (more details), 2.7 Å

PDB Description: crystal structure of fab-estradiol complexes
PDB Compounds: (A:) monoclonal anti-estradiol 10g6d6 immunoglobulin lambda chain

SCOPe Domain Sequences for d1jn6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn6a2 b.1.1.2 (A:113-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
ksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsn
nkymassyltltarawerhssyscqvtheghtveksls

SCOPe Domain Coordinates for d1jn6a2:

Click to download the PDB-style file with coordinates for d1jn6a2.
(The format of our PDB-style files is described here.)

Timeline for d1jn6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jn6a1