Lineage for d1jn0o2 (1jn0 O:149-312)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193860Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 193861Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 193862Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 193870Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)
  7. 193967Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (1 PDB entry)
  8. 193970Domain d1jn0o2: 1jn0 O:149-312 [66920]
    Other proteins in same PDB: d1jn0a1, d1jn0b1, d1jn0o1

Details for d1jn0o2

PDB Entry: 1jn0 (more details), 3 Å

PDB Description: Crystal structure of the non-regulatory A4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with NADP

SCOP Domain Sequences for d1jn0o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn0o2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpqlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadqelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOP Domain Coordinates for d1jn0o2:

Click to download the PDB-style file with coordinates for d1jn0o2.
(The format of our PDB-style files is described here.)

Timeline for d1jn0o2: