Lineage for d1jn0a1 (1jn0 A:0-148,A:313-333)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175469Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
  6. 175557Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 175654Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (1 PDB entry)
  8. 175655Domain d1jn0a1: 1jn0 A:0-148,A:313-333 [66915]
    Other proteins in same PDB: d1jn0a2, d1jn0b2, d1jn0o2

Details for d1jn0a1

PDB Entry: 1jn0 (more details), 3 Å

PDB Description: Crystal structure of the non-regulatory A4 isoform of spinach chloroplast glyceraldehyde-3-phosphate dehydrogenase complexed with NADP

SCOP Domain Sequences for d1jn0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn0a1 c.2.1.3 (A:0-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
klkvaingfgrigrnflrcwhgkdspldvvvindtggvkqashllkydsilgtfdadvkt
agdsaisvgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvlit
apgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

SCOP Domain Coordinates for d1jn0a1:

Click to download the PDB-style file with coordinates for d1jn0a1.
(The format of our PDB-style files is described here.)

Timeline for d1jn0a1: