Lineage for d1jmzg_ (1jmz G:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449350Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (10 superfamilies)
    not a true fold
  4. 449432Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) (S)
  5. 449433Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein)
  6. 449434Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species)
  7. 449438Species Pseudomonas putida [TaxId:303] [69135] (2 PDB entries)
  8. 449440Domain d1jmzg_: 1jmz G: [66914]
    Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza3, d1jmza4, d1jmza5, d1jmzb_

Details for d1jmzg_

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor

SCOP Domain Sequences for d1jmzg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmzg_ a.137.9.1 (G:) Quinohemoprotein amine dehydrogenase C chain {Pseudomonas putida}
avagctattdpgwevdafggvsslcqpmeadlygcsdpcwxpaqvpdmmstyqdwnaqas
nsaedwrnlgtvfpkdk

SCOP Domain Coordinates for d1jmzg_:

Click to download the PDB-style file with coordinates for d1jmzg_.
(The format of our PDB-style files is described here.)

Timeline for d1jmzg_: