Lineage for d1jmza3 (1jmz A:282-363)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 659171Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)
  6. 659172Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
    duplication: tandem repeat of two Ig-like domains
  7. 659178Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)
  8. 659181Domain d1jmza3: 1jmz A:282-363 [66910]
    Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza5, d1jmzb_, d1jmzg_

Details for d1jmza3

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
PDB Compounds: (A:) Amine Dehydrogenase

SCOP Domain Sequences for d1jmza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmza3 b.1.18.14 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida [TaxId: 303]}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd

SCOP Domain Coordinates for d1jmza3:

Click to download the PDB-style file with coordinates for d1jmza3.
(The format of our PDB-style files is described here.)

Timeline for d1jmza3: