![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein) |
![]() | Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) duplication: tandem repeat of two Ig-like domains |
![]() | Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries) |
![]() | Domain d1jmza3: 1jmz A:282-363 [66910] Other proteins in same PDB: d1jmza1, d1jmza2, d1jmza5, d1jmzb_, d1jmzg_ |
PDB Entry: 1jmz (more details), 2 Å
SCOP Domain Sequences for d1jmza3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmza3 b.1.18.14 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida} gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad akpgqrevavgtlkgvnlavyd
Timeline for d1jmza3:
![]() Domains from same chain: (mouse over for more information) d1jmza1, d1jmza2, d1jmza4, d1jmza5 |