Lineage for d1jmza2 (1jmz A:86-162)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 350824Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 350825Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 351209Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein)
  6. 351210Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species)
    duplication: tandem repeat of two cytochrome c-like domains
  7. 351216Species Pseudomonas putida [TaxId:303] [68959] (2 PDB entries)
  8. 351220Domain d1jmza2: 1jmz A:86-162 [66909]
    Other proteins in same PDB: d1jmza3, d1jmza4, d1jmza5, d1jmzb_, d1jmzg_
    complexed with hec, ni, pnd, trq

Details for d1jmza2

PDB Entry: 1jmz (more details), 2 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor

SCOP Domain Sequences for d1jmza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmza2 a.3.1.7 (A:86-162) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Pseudomonas putida}
lntveqfdtqlsetcgrchsgarvalqrrpakewehlvnfhlgqwpsleyqaqardrdwl
pialqqvvpdlakrypl

SCOP Domain Coordinates for d1jmza2:

Click to download the PDB-style file with coordinates for d1jmza2.
(The format of our PDB-style files is described here.)

Timeline for d1jmza2: