Lineage for d1jmxg_ (1jmx G:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 101588Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)
  4. 101656Superfamily a.137.9: Quinohemoprotein amine dehydrogenase C chain [69131] (1 family) (S)
  5. 101657Family a.137.9.1: Quinohemoprotein amine dehydrogenase C chain [69132] (1 protein)
  6. 101658Protein Quinohemoprotein amine dehydrogenase C chain [69133] (2 species)
  7. 101661Species Pseudomonas putida [TaxId:303] [69135] (2 PDB entries)
  8. 101662Domain d1jmxg_: 1jmx G: [66907]
    Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa3, d1jmxa4, d1jmxa5, d1jmxb_

Details for d1jmxg_

PDB Entry: 1jmx (more details), 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida

SCOP Domain Sequences for d1jmxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmxg_ a.137.9.1 (G:) Quinohemoprotein amine dehydrogenase C chain {Pseudomonas putida}
avagctattdpgwevdafggvsslcqpmeadlygcsdpcwxpaqvpdmmstyqdwnaqas
nsaedwrnlgtvfpkdk

SCOP Domain Coordinates for d1jmxg_:

Click to download the PDB-style file with coordinates for d1jmxg_.
(The format of our PDB-style files is described here.)

Timeline for d1jmxg_: