Lineage for d1jmxb_ (1jmx B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675262Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 675277Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) (S)
  5. 675314Family b.69.2.2: Quinohemoprotein amine dehydrogenase B chain [69309] (1 protein)
    less regular propeller with imperfect sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    this is a repeat family; one repeat unit is 1jmx B:256-296 found in domain
  6. 675315Protein Quinohemoprotein amine dehydrogenase B chain [69310] (2 species)
  7. 675319Species Pseudomonas putida [TaxId:303] [69312] (2 PDB entries)
  8. 675320Domain d1jmxb_: 1jmx B: [66906]
    Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa3, d1jmxa4, d1jmxa5, d1jmxg_
    complexed with hec, ni, trq

Details for d1jmxb_

PDB Entry: 1jmx (more details), 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
PDB Compounds: (B:) Amine Dehydrogenase

SCOP Domain Sequences for d1jmxb_:

Sequence, based on SEQRES records: (download)

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}
gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
lrnwnrkgysapdvlyfwphqsprhefsmlytiarfkddkqdpatadllygylsvdlktg
kthtqefadltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafd
kkgdklylggtfndlavfnpdtlekvkniklpggdmstttpqvfir

Sequence, based on observed residues (ATOM records): (download)

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}
gpalkagheymivtnypnnlhvvdvasdtvykscvmpdkfgpgtammapdnrtayvlnnh
ygdiygidldtckntfhanlssvpgevgrsmysfaispdgkevyatvnptqrlndhyvvk
pprlevfstadgleakpvrtfpmprqvylmraaddgslyvagpdiykmdvktgkytvalp
lrnwnrkgysapdvlyfwphqsprhefsmlytiarfatadllygylsvdlktgkthtqef
adltelyftglrspkdpnqiygvlnrlakydlkqrklikaanldhtyycvafdkkgdkly
lggtfndlavfnpdtlekvkniklpggdmstttpqvfir

SCOP Domain Coordinates for d1jmxb_:

Click to download the PDB-style file with coordinates for d1jmxb_.
(The format of our PDB-style files is described here.)

Timeline for d1jmxb_: