Lineage for d1jmxa5 (1jmx A:163-281)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 958655Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 959075Superfamily b.61.4: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69298] (1 family) (S)
  5. 959076Family b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69299] (1 protein)
  6. 959077Protein Quinohemoprotein amine dehydrogenase A chain, domain 3 [69300] (2 species)
  7. 959081Species Pseudomonas putida [TaxId:303] [69302] (2 PDB entries)
  8. 959082Domain d1jmxa5: 1jmx A:163-281 [66905]
    Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa3, d1jmxa4, d1jmxb_, d1jmxg_
    complexed with hec, ni

Details for d1jmxa5

PDB Entry: 1jmx (more details), 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
PDB Compounds: (A:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmxa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmxa5 b.61.4.1 (A:163-281) Quinohemoprotein amine dehydrogenase A chain, domain 3 {Pseudomonas putida [TaxId: 303]}
esaawaewqkarpkadalpgqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgt
pfngsgsailyngyewrgnvkvgdanlrqvfaaldgemkgrmfeaehdergldftavke

SCOPe Domain Coordinates for d1jmxa5:

Click to download the PDB-style file with coordinates for d1jmxa5.
(The format of our PDB-style files is described here.)

Timeline for d1jmxa5: