Lineage for d1jmxa5 (1jmx A:163-281)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.61: Streptavidin-like [50875] (5 superfamilies)
barrel, closed; n=8, S=10; meander
Superfamily b.61.4: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69298] (1 family) 
Family b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69299] (1 protein) Protein Quinohemoprotein amine dehydrogenase A chain, domain 3 [69300] (2 species) Species Pseudomonas putida [TaxId:303] [69302] (2 PDB entries) 
Domain d1jmxa5: 1jmx A:163-281 [66905]
Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa3, d1jmxa4, d1jmxb_, d1jmxg_
complexed with hec, ni, trq
Details for d1jmxa5
PDB Entry: 1jmx (more details), 1.9 Å
PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
SCOP Domain Sequences for d1jmxa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmxa5 b.61.4.1 (A:163-281) Quinohemoprotein amine dehydrogenase A chain, domain 3 {Pseudomonas putida}
esaawaewqkarpkadalpgqwafsghmlakgdvrgvmsvtpdqgdtfkvevkgayadgt
pfngsgsailyngyewrgnvkvgdanlrqvfaaldgemkgrmfeaehdergldftavke
SCOP Domain Coordinates for d1jmxa5:
Click to download the PDB-style file with coordinates for d1jmxa5.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jmxa5:
- d1jmxa5 first appeared in SCOP 1.59
- d1jmxa5 appears in SCOP 1.61
- d1jmxa5 appears in SCOP 1.65
- d1jmxa5 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jmxa1, d1jmxa2, d1jmxa3, d1jmxa4 |
