![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein) |
![]() | Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species) duplication: tandem repeat of two Ig-like domains |
![]() | Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries) |
![]() | Domain d1jmxa4: 1jmx A:364-494 [66904] Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_ complexed with hec, ni, trq |
PDB Entry: 1jmx (more details), 1.9 Å
SCOP Domain Sequences for d1jmxa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmxa4 b.1.18.14 (A:364-494) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida} kveevkvvpafsiarigengasvpkvqgrfeaeawgkdangqplrigylpaswkvepfne ravededvkfagkmqadgvfvpggagpnperkmmtnnagnlkviatladggqtgeghmiv tvqrwnnpplp
Timeline for d1jmxa4:
![]() Domains from same chain: (mouse over for more information) d1jmxa1, d1jmxa2, d1jmxa3, d1jmxa5 |