SCOPe 2.07: Domain d1jmxa3: 1jmx A:282-363

Lineage for d1jmxa3 (1jmx A:282-363)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.14: Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [81294] (1 protein)

6. Protein Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 [69176] (2 species)
   duplication: tandem repeat of two Ig-like domains

7. Species Pseudomonas putida [TaxId:303] [69178] (2 PDB entries)

8. Domain d1jmxa3: 1jmx A:282-363 [66903]
   Other proteins in same PDB: d1jmxa1, d1jmxa2, d1jmxa5, d1jmxb_, d1jmxg_
   complexed with hec, ni

Details for d1jmxa3

PDB Entry: 1jmx, 1.9 Å

PDB Description: crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida

PDB Compounds: (A:) Amine Dehydrogenase

SCOPe Domain Sequences for d1jmxa3:

Sequence; same for both SEQRES and ATOM records:

>d1jmxa3 b.1.18.14 (A:282-363) Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 {Pseudomonas putida [TaxId: 303]}
gkarllavqpafikaggeseitlvgsglagkpdlgagvevtevleqtptlvrlkaraaad
akpgqrevavgtlkgvnlavyd

Timeline for d1jmxa3:

• d1jmxa3 first appeared in SCOP 1.59
  
• d1jmxa3 appears in SCOPe 2.06
  
• d1jmxa3 appears in the current release, SCOPe 2.08