![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein) |
![]() | Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species) duplication: tandem repeat of two cytochrome c-like domains |
![]() | Species Pseudomonas putida [TaxId:303] [68959] (2 PDB entries) |
![]() | Domain d1jmxa1: 1jmx A:2-85 [66901] Other proteins in same PDB: d1jmxa3, d1jmxa4, d1jmxa5, d1jmxb_, d1jmxg_ |
PDB Entry: 1jmx (more details), 1.9 Å
SCOP Domain Sequences for d1jmxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmxa1 a.3.1.7 (A:2-85) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Pseudomonas putida} eqgpsllqnkcmgchipegndtysrishqrktpegwlmsiarmqvmhglqisdddrrtlv kyladkqglapsetdgvryamerr
Timeline for d1jmxa1:
![]() Domains from same chain: (mouse over for more information) d1jmxa2, d1jmxa3, d1jmxa4, d1jmxa5 |