Lineage for d1jm7a_ (1jm7 A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271595Fold g.44: RING finger domain, C3HC4 [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 271596Superfamily g.44.1: RING finger domain, C3HC4 [57850] (1 family) (S)
  5. 271597Family g.44.1.1: RING finger domain, C3HC4 [57851] (9 proteins)
  6. 271604Protein brca1 RING domain [69968] (1 species)
  7. 271605Species Human (Homo sapiens) [TaxId:9606] [69969] (1 PDB entry)
  8. 271606Domain d1jm7a_: 1jm7 A: [66880]
    Other proteins in same PDB: d1jm7b_
    heterodimer with bard1 RING domain
    complexed with zn

Details for d1jm7a_

PDB Entry: 1jm7 (more details)

PDB Description: solution structure of the brca1/bard1 ring-domain heterodimer

SCOP Domain Sequences for d1jm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens)}
mdlsalrveevqnvinamqkilecpiclelikepvstkcdhifckfcmlkllnqkkgpsq
cplcknditkrslqestrfsqlveellkiicafqldtgleyan

SCOP Domain Coordinates for d1jm7a_:

Click to download the PDB-style file with coordinates for d1jm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1jm7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jm7b_