Lineage for d1jlle2 (1jll E:1-238)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734347Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 734348Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) (S)
  5. 734526Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 734527Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 734528Species Escherichia coli [TaxId:562] [56083] (6 PDB entries)
  8. 734538Domain d1jlle2: 1jll E:1-238 [66858]
    Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb1, d1jlld1, d1jlld2, d1jlle1
    complexed with coa, po4, so4; mutant

Details for d1jlle2

PDB Entry: 1jll (more details), 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs
PDB Compounds: (E:) succinyl-CoA synthetase beta subunit

SCOP Domain Sequences for d1jlle2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlle2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlaliainplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOP Domain Coordinates for d1jlle2:

Click to download the PDB-style file with coordinates for d1jlle2.
(The format of our PDB-style files is described here.)

Timeline for d1jlle2: