SCOP 1.61: Domain d1jlle2: 1jll E:1-238

Lineage for d1jlle2 (1jll E:1-238)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)

7. Species Escherichia coli [TaxId:562] [56083] (6 PDB entries)

8. Domain d1jlle2: 1jll E:1-238 [66858]
   Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb1, d1jlld1, d1jlld2, d1jlle1

Details for d1jlle2

PDB Entry: 1jll, 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs

SCOP Domain Sequences for d1jlle2:

Sequence; same for both SEQRES and ATOM records:

>d1jlle2 d.142.1.4 (E:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlaliainplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

Timeline for d1jlle2:

• d1jlle2 first appeared in SCOP 1.59
  
• d1jlle2 appears in SCOP 1.63
  
• d1jlle2 appears in the current release, SCOPe 2.08