Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species) |
Species Escherichia coli [TaxId:562] [52216] (11 PDB entries) |
Domain d1jlle1: 1jll E:239-385 [66857] Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb2, d1jlld1, d1jlld2, d1jlle2 complexed with coa, po4, so4; mutant |
PDB Entry: 1jll (more details), 2.69 Å
SCOP Domain Sequences for d1jlle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlle1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga kkladsglniiaakgltdaaqqvvaav
Timeline for d1jlle1: