SCOP 1.75: Domain d1jlle1: 1jll E:239-385

Lineage for d1jlle1 (1jll E:239-385)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
Species Escherichia coli [TaxId:562] [52216] (11 PDB entries)
Domain d1jlle1: 1jll E:239-385 [66857]
Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb2, d1jlld1, d1jlld2, d1jlle2
complexed with coa, po4, so4; mutant

Details for d1jlle1

PDB Entry: 1jll (more details), 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs

PDB Compounds: (E:) succinyl-CoA synthetase beta subunit

SCOP Domain Sequences for d1jlle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlle1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOP Domain Coordinates for d1jlle1:

Click to download the PDB-style file with coordinates for d1jlle1.
(The format of our PDB-style files is described here.)

Timeline for d1jlle1: