SCOP 1.59: Domain d1jlle1: 1jll E:239-385

Lineage for d1jlle1 (1jll E:239-385)

Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
Species Escherichia coli [TaxId:562] [52216] (6 PDB entries)
Domain d1jlle1: 1jll E:239-385 [66857]
Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb2, d1jlld1, d1jlld2, d1jlle2

Details for d1jlle1

PDB Entry: 1jll (more details), 2.69 Å

PDB Description: crystal structure analysis of the e197betaa mutant of e. coli scs

SCOP Domain Sequences for d1jlle1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlle1 c.23.4.1 (E:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaav

SCOP Domain Coordinates for d1jlle1:

Click to download the PDB-style file with coordinates for d1jlle1.
(The format of our PDB-style files is described here.)

Timeline for d1jlle1: