Lineage for d1jllb1 (1jll B:239-388)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120347Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 120348Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 120366Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 120367Species Escherichia coli [TaxId:562] [52216] (6 PDB entries)
  8. 120374Domain d1jllb1: 1jll B:239-388 [66853]
    Other proteins in same PDB: d1jlla1, d1jlla2, d1jllb2, d1jlld1, d1jlld2, d1jlle2

Details for d1jllb1

PDB Entry: 1jll (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of the E197betaA Mutant of E. coli SCS

SCOP Domain Sequences for d1jllb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jllb1 c.23.4.1 (B:239-388) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli}
dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv
teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga
kkladsglniiaakgltdaaqqvvaavegk

SCOP Domain Coordinates for d1jllb1:

Click to download the PDB-style file with coordinates for d1jllb1.
(The format of our PDB-style files is described here.)

Timeline for d1jllb1: