Lineage for d1jlla2 (1jll A:122-287)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120347Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 120348Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 120349Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (2 species)
  7. 120350Species Escherichia coli [TaxId:562] [52213] (6 PDB entries)
  8. 120357Domain d1jlla2: 1jll A:122-287 [66852]
    Other proteins in same PDB: d1jlla1, d1jllb1, d1jllb2, d1jlld1, d1jlle1, d1jlle2

Details for d1jlla2

PDB Entry: 1jll (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of the E197betaA Mutant of E. coli SCS

SCOP Domain Sequences for d1jlla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlla2 c.23.4.1 (A:122-287) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktvl

SCOP Domain Coordinates for d1jlla2:

Click to download the PDB-style file with coordinates for d1jlla2.
(The format of our PDB-style files is described here.)

Timeline for d1jlla2: