Lineage for d1jlla1 (1jll A:1-121)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118988Family c.2.1.8: Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51900] (1 protein)
  6. 118989Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (2 species)
  7. 118990Species Escherichia coli [TaxId:562] [51902] (6 PDB entries)
  8. 118997Domain d1jlla1: 1jll A:1-121 [66851]
    Other proteins in same PDB: d1jlla2, d1jllb1, d1jllb2, d1jlld2, d1jlle1, d1jlle2

Details for d1jlla1

PDB Entry: 1jll (more details), 2.69 Å

PDB Description: Crystal Structure Analysis of the E197betaA Mutant of E. coli SCS

SCOP Domain Sequences for d1jlla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlla1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli}
silidkntkvicqgftgsqgtfhseqaiaygtkmvggvtpgkggtthlglpvfntvreav
aatgatasviyvpapfckdsileaidagikliititegiptldmltvkvkldeagvrmig
p

SCOP Domain Coordinates for d1jlla1:

Click to download the PDB-style file with coordinates for d1jlla1.
(The format of our PDB-style files is described here.)

Timeline for d1jlla1: